PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G21720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 648aa    MW: 72239.5 Da    PI: 6.1215
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G21720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.8e-094074441954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  OGLUM12G21720.1 407 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 444
                      665559******************************88 PP

2BELL121.63.4e-39270341172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e+qelq+k akL+ +l+eVd++Yk+y++q+qtv+ssF++vag gsakpYt++Al++iSrhFrcLkdai +qi
  OGLUM12G21720.1 270 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQTVVSSFDVVAGPGSAKPYTAVALQTISRHFRCLKDAINDQI 341
                      689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-58194339IPR006563POX domain
PfamPF075262.5E-51200337IPR006563POX domain
PROSITE profilePS5007112.325385448IPR001356Homeobox domain
SMARTSM003893.6E-9388452IPR001356Homeobox domain
CDDcd000865.72E-12388449No hitNo description
SuperFamilySSF466892.87E-17389454IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28391454IPR009057Homeodomain-like
PfamPF059201.0E-17405444IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MATYYSSPGS ERDSQTMYSR DPGSASYPMS SALGNLLYLN NPSSGPYTEF SGILQPQQNC  60
MEMPGPGHAS AMSQDPSSRE SDMLASHQGQ RSFSHVKDMK NEMLMHMMDG AQGSGSELIH  120
DDAHTGSQLE FGVLNNHNSS SVPSMQSQGL SLSLNTQIMA PSLPYWSIKP DMLTPQSYHD  180
NLRGEDMRMK NLQSEASRAI RNSRYLKAAQ ELLDEVVSVW KSIKQKAQKE KVESGKADGK  240
ETDGGPKSEG VSSNPQESGA NAAPELSTAE KQELQNKMAK LMAMLDEVDR KYKHYYHQMQ  300
TVVSSFDVVA GPGSAKPYTA VALQTISRHF RCLKDAINDQ INVIRKKLGE EENSSGKEGK  360
LTRLRYIDQQ LRQQRAFQQY GMIPQNAWRP QRGLPENSVT ILRAWLFEHF LHPYPKDSEK  420
LMLARQTGLT RSQISNWFIN ARVRLWKPMI EDMYKEEIGD LEQDSNSSSD NAPRSKDKMA  480
SSEDREDLKN SRARICETSQ LSESRTSIGA MNVGGAPVGF QNEPNPDDSF MNLMLKDQRS  540
NEVDGGLLLH NTVTQHSDEN ARFMAYHLAE LGRYGNGNVS LTLGLQHSSS NLVVPNAQPG  600
FPGVNEDDIY NATAPLGVTV ASSDYDSMNQ MDQRQRFEHS PLLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16394451158Homeobox protein Meis1
4xrs_B3e-16394451158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0704650.0AK070465.1 Oryza sativa Japonica Group cDNA clone:J023054P21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619823.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_015619822.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0E0BVN80.0A0A0E0BVN8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA035766-PA0.0(Oryza sativa Indica Group)
STRINGORGLA12G0172800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-112BEL1-like homeodomain 6